PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G123100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 304aa    MW: 34879.3 Da    PI: 6.7945
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G123100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.2e-52131421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         l pGfrF+Ptdeel+++yL +kv+++++ + ++i evd++k+ePw+Lp+k+k     ++ewyf+ ++d+ky+t++r+nrat++gyWk tgk
  Brast09G123100.1.p  13 LEPGFRFQPTDEELISFYLSQKVKDRSFCT-TAIGEVDMNKCEPWELPMKAKMsgpATTEWYFYYQKDRKYPTSHRTNRATEAGYWKITGK 102
                         579************************988.78***************64443334566******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dke+++ +g l+g+kktLvfy grap+g+kt+Wvmheyr+
  Brast09G123100.1.p 103 DKEIFHGRGILIGMKKTLVFYMGRAPNGKKTNWVMHEYRI 142
                         **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-557176IPR003441NAC domain
PROSITE profilePS5100554.77713176IPR003441NAC domain
PfamPF023651.3E-2615142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGDHLHHQQH LDLEPGFRFQ PTDEELISFY LSQKVKDRSF CTTAIGEVDM NKCEPWELPM  60
KAKMSGPATT EWYFYYQKDR KYPTSHRTNR ATEAGYWKIT GKDKEIFHGR GILIGMKKTL  120
VFYMGRAPNG KKTNWVMHEY RIVSNNDKLS SYRTNDTIPE SSNPKDEWVV CRIFQKSNGI  180
NEVLVPVYPM VPMNNDQIMP PRDQQQGFDT STTPCTQTIQ LPPLMDPASS MYQLYDNTGS  240
SSLAPLPTND LYFANNQTPP MSLYHHHLQM PTQLGATTDD GFLGTDTWDI VHAVMGPQYH  300
HHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-4621781167NO APICAL MERISTEM PROTEIN
1ut4_B8e-4621781167NO APICAL MERISTEM PROTEIN
1ut7_A8e-4621781167NO APICAL MERISTEM PROTEIN
1ut7_B8e-4621781167NO APICAL MERISTEM PROTEIN
4dul_A8e-4621781167NAC domain-containing protein 19
4dul_B8e-4621781167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581365.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ26e-69NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0Q3KSU20.0A0A0Q3KSU2_BRADI; Uncharacterized protein
STRINGSi030284m3e-76(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-69Arabidopsis NAC domain containing protein 87